(data stored in ACNUC7421 zone)

EMBL: CP000675.FUR

CP000675.FUR         Location/Qualifiers
FT   CDS             465232..465642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="LPC_2972"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56873"
FT                   /protein_id="ABQ56873.1"
FT                   /translation="MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLES
FT                   GEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDE
FT                   IIEQRQKAIAERAHFKMTDHALNIYGICPQCQ"
     MEESQQLKDA GLKITLPRIK VLQILEQSRN HHLSAEAVYK ALLESGEDVG LATVYRVLTQ        60
     FEAAGLVSRH NFEGGHSVFE LSQGEHHDHL VCVKCGRVEE FVDEIIEQRQ KAIAERAHFK       120
     MTDHALNIYG ICPQCQ                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page