(data stored in ACNUC7421 zone)

EMBL: CP000675.GCSB

CP000675.GCSB        Location/Qualifiers
FT   CDS             complement(140568..142022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsB"
FT                   /locus_tag="LPC_0134"
FT                   /product="glycine cleavage system protein P"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54133"
FT                   /db_xref="GOA:A5I9T3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T3"
FT                   /protein_id="ABQ54133.1"
FT                   /translation="MLIFELSKTGRQAKAQIPRAVGKNYSIPEEFQRKSPPRLPACSEL
FT                   QVVRHFTCLSQKNFSIDTNFYPLGSCTMKYNPRGVHKAASLPGFINRHPLAMDNESQGF
FT                   LETLYKLQNYISEITGMPGVSLTPMAGSQGEFAGVAMIKAYHQSRGDTARDEILIPDAA
FT                   HGTNPASAVMCGFKVVEIATAPDGDIDLDELKRKVGPRTAGIMLTNPSTLGLFMRQIKE
FT                   IASLVHQAGGLLYYDGANLNAILGKVRPGDMGFDVMHLNLHKTFATPHGGGGPGAGPVA
FT                   VGKRLIPYMPLPVVKKTDSGYHWATRQDYPQSIGRLSCFMGNAGILLRAYFYMLVLGKE
FT                   GLLRVSEFATLNANYLLKELTKVGYTAAYPDRRASHEFILTLNSEKKNYDVTAMDFAKR
FT                   LLDYGVHAPTTYFPLLVPECLLIEPPETESKEELDAFVAVMKTIREEASKQPDILKTAP
FT                   HTLPVKRLDDVKAARELDLNYFATHE"
     MLIFELSKTG RQAKAQIPRA VGKNYSIPEE FQRKSPPRLP ACSELQVVRH FTCLSQKNFS        60
     IDTNFYPLGS CTMKYNPRGV HKAASLPGFI NRHPLAMDNE SQGFLETLYK LQNYISEITG       120
     MPGVSLTPMA GSQGEFAGVA MIKAYHQSRG DTARDEILIP DAAHGTNPAS AVMCGFKVVE       180
     IATAPDGDID LDELKRKVGP RTAGIMLTNP STLGLFMRQI KEIASLVHQA GGLLYYDGAN       240
     LNAILGKVRP GDMGFDVMHL NLHKTFATPH GGGGPGAGPV AVGKRLIPYM PLPVVKKTDS       300
     GYHWATRQDY PQSIGRLSCF MGNAGILLRA YFYMLVLGKE GLLRVSEFAT LNANYLLKEL       360
     TKVGYTAAYP DRRASHEFIL TLNSEKKNYD VTAMDFAKRL LDYGVHAPTT YFPLLVPECL       420
     LIEPPETESK EELDAFVAVM KTIREEASKQ PDILKTAPHT LPVKRLDDVK AARELDLNYF       480
     ATHE                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page