(data stored in ACNUC7421 zone)

EMBL: CP000675.GCVH

CP000675.GCVH        Location/Qualifiers
FT   CDS             complement(143697..144074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="LPC_0137"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54136"
FT                   /db_xref="GOA:A5I9T6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T6"
FT                   /protein_id="ABQ54136.1"
FT                   /translation="MNDLKFTTTHEWLREDEEEVTVGITDHAQELLGDMVFVELPEIGD
FT                   EVSAGQELGVVESVKAASDFYAPISGVVTAVNEAVGKNPALVNHDPYHEGWLVKLKPSH
FT                   PDEIKSLLSDEQYQNEIAEEN"
     MNDLKFTTTH EWLREDEEEV TVGITDHAQE LLGDMVFVEL PEIGDEVSAG QELGVVESVK        60
     AASDFYAPIS GVVTAVNEAV GKNPALVNHD PYHEGWLVKL KPSHPDEIKS LLSDEQYQNE       120
     IAEEN                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page