(data stored in ACNUC7421 zone)

EMBL: CP000675.GCVT

CP000675.GCVT        Location/Qualifiers
FT   CDS             complement(144108..145190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="LPC_0138"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54137"
FT                   /db_xref="GOA:A5I9T7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T7"
FT                   /protein_id="ABQ54137.1"
FT                   /translation="MTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHHAVRNDAG
FT                   MFDVSHMTIVDILGAGGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIIDDLIVYQR
FT                   ASDNYRVVLNSATRQNDVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKTLSILAPA
FT                   HVDAVSTLTPFECVDVDHWFFARTGYTGEDGLEIIVPNEFITQLWNDLLNAGVTPCGLG
FT                   ARDTLRLEAGMLLYGQDMDETTTPLESGLAWTVKWEPEDRGFIGMGALVSQKQQGIKRK
FT                   MVGLTLLDKGIMRHGQKVIIEGCPDGIITSGSYSPTLQQSIALARVPVETGEQVLVDIR
FT                   GKLIPAKVGKPRFIKQGKPV"
     MTAKTPLHTT HLACGAKMVD FHGWDMPLHY GSQLNEHHAV RNDAGMFDVS HMTIVDILGA        60
     GGRQFLRKLL TNDVDQITHN GKALYSCMCN EHGGIIDDLI VYQRASDNYR VVLNSATRQN       120
     DVAWIRAKSE GFAVGLQERR ELSMLAVQGP NAIAKTLSIL APAHVDAVST LTPFECVDVD       180
     HWFFARTGYT GEDGLEIIVP NEFITQLWND LLNAGVTPCG LGARDTLRLE AGMLLYGQDM       240
     DETTTPLESG LAWTVKWEPE DRGFIGMGAL VSQKQQGIKR KMVGLTLLDK GIMRHGQKVI       300
     IEGCPDGIIT SGSYSPTLQQ SIALARVPVE TGEQVLVDIR GKLIPAKVGK PRFIKQGKPV       360
//

If you have problems or comments...

PBIL Back to PBIL home page