(data stored in ACNUC7421 zone)

EMBL: CP000675.HFLK

CP000675.HFLK        Location/Qualifiers
FT   CDS             575814..576956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="LPC_2860"
FT                   /product="protease subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56761"
FT                   /protein_id="ABQ56761.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VQQSGNLKAIKNGANVSNEEDNLILSGRDLTRPTYSQGRD"
     MGWNEPEKGK DPWSGKNQPP DLDEALKRIQ DKLKKTFFGG TGKSNNNSSG GSSGGLLAVT        60
     VLLIAFILWA LSGIFIVDPA EQAVILRFGK YAETVGPGPH WIPRFISSKI VMNVDRVLDY       120
     SYSAQMLTSD ENLVSVSLAV QYRINDLSEY LFNVANPEES LQQATSSALR QVVGTTTLDQ       180
     IITEGREVWG GRVQETLTKT LESYKTGILI VNVSPQPARA PESVQDAFDD AIKAQEDEKR       240
     FKEQAYAYAA KVVPIAEGKA SRIQQEAEAY SKQVVLRAQG EVAEFLALLP QYNAAPQVTA       300
     KRMYLEAMQK VMNKSSTIIV DSKAGNLLYL PLDKLLGNQY VQQSGNLKAI KNGANVSNEE       360
     DNLILSGRDL TRPTYSQGRD                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page