(data stored in ACNUC7421 zone)

EMBL: CP000675.HFQ

CP000675.HFQ         Location/Qualifiers
FT   CDS             13054..13311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="LPC_0010"
FT                   /product="host factor-I protein for bacteriophage Q beta
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54010"
FT                   /db_xref="GOA:A5I9G0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9G0"
FT                   /protein_id="ABQ54010.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
     MSKNHLLQDP FLNELRKEKV PVSVFLVNGI KLHGIIDSFD QYVVMLKNSI TQMVYKHAIS        60
     TVVPSRMVKI PAEESSGEEE GTVAD                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page