(data stored in ACNUC7421 zone)

EMBL: CP000675.HSLU

CP000675.HSLU        Location/Qualifiers
FT   CDS             776208..777551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="LPC_2652"
FT                   /product="ATP dependent Hsl protease, ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2652"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56566"
FT                   /protein_id="ABQ56566.1"
FT                   /translation="MMKANNMVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKI
FT                   KDPVLRNEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDS
FT                   IIRDLTDMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFR
FT                   KQLREGELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVA
FT                   KAMKILREEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGV
FT                   QRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALS
FT                   VEDFVRILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRL
FT                   YTVMERLLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
     MMKANNMVMT PREIVQELDK HIIGQDDAKR AVAIALRNRW RRMKIKDPVL RNEIMPKNIL        60
     MIGPTGVGKT EIARRLANLA KAPFIKVEAT KFTEVGYVGR DVDSIIRDLT DMAIKQEREF       120
     AMKKVEHLAE DAAEERILDV LLPPARGTLT PGEKNTTARQ VFRKQLREGE LNDNEIEIEV       180
     AATPVGIEIM APPGMEEMTS QLQSMFQQVG SYRTKTRKMT VAKAMKILRE EEAAKLINEE       240
     DIKLKAIESV EQNGIVFIDE LDKIAKRSDT VSGGDVSREG VQRDLLPLVE GTTVSTKYGM       300
     VKSDHILFIA SGAFHVAKPS DLIAELQGRL PIRVELSALS VEDFVRILTE PSASLTLQYS       360
     ALMETEGLTL TFDETGIRRI AEVAWQVNER TENIGARRLY TVMERLLEVV SFEATDKAGE       420
     TVHVDKAYVD KNLGQLIADE DLARYIL                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page