(data stored in ACNUC7421 zone)

EMBL: CP000675.HSLV

CP000675.HSLV        Location/Qualifiers
FT   CDS             775676..776224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="LPC_2653"
FT                   /product="heat shock protein, HslVU, proteasome-related
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2653"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56567"
FT                   /db_xref="GOA:A5IGR7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGR7"
FT                   /protein_id="ABQ56567.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
     MEQFHGTTIL SVRRGNQVVI GGDGQVTLGN TVMKGNARKV RRLYKDKVIA GFAGGTADAF        60
     TLFERFEAKL EMHQGHLIRA AVELAKDWRT DRILRRLEAV LAVADSKASL IITGNGDVIE       120
     PEESLIAIGS GGPFAQAAAR ALMENTQLSA KEIVQKALTI AGDICIYTNN NLTIEELNDE       180
     GK                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page