(data stored in ACNUC7421 zone)

EMBL: CP000675.HTPB

CP000675.HTPB        Location/Qualifiers
FT   CDS             849465..851111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpB"
FT                   /locus_tag="LPC_2606"
FT                   /product="Hsp60, 60K heat shock protein HtpB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56521"
FT                   /db_xref="GOA:A5IGM1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGM1"
FT                   /protein_id="ABQ56521.1"
FT                   /translation="MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGA
FT                   PTVTKDGVSVAKEIEFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHK
FT                   AVAAGMNPMDLKRGIDKAVLAVTKKLQAMSKPCKDSKAIAQVGTISANSDEAIGAIIAE
FT                   AMEKVGKEGVITVEDGNGLENELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLV
FT                   DKKVSSIREMLSVLEGVAKSGRPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFG
FT                   DRRKAMLQDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTVIDGEGKATE
FT                   INARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAG
FT                   YEASVVVNKVAEHKDNYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTE
FT                   CMVADLPKKEEGVGAGDMGGMGGMGGMGGMM"
     MAKELRFGDD ARLQMLAGVN ALADAVQVTM GPRGRNVVLE KSYGAPTVTK DGVSVAKEIE        60
     FEHRFMNMGA QMVKEVASKT SDTAGDGTTT ATVLARSILV EGHKAVAAGM NPMDLKRGID       120
     KAVLAVTKKL QAMSKPCKDS KAIAQVGTIS ANSDEAIGAI IAEAMEKVGK EGVITVEDGN       180
     GLENELSVVE GMQFDRGYIS PYFINNQQNM SCELEHPFIL LVDKKVSSIR EMLSVLEGVA       240
     KSGRPLLIIA EDVEGEALAT LVVNNMRGIV KVCAVKAPGF GDRRKAMLQD IAILTKGQVI       300
     SEEIGKSLEG ATLEDLGSAK RIVVTKENTT VIDGEGKATE INARIAQIRA QMEETTSDYD       360
     REKLQERVAK LAGGVAVIKV GAATEVEMKE KKARVEDALH ATRAAVEEGI VAGGGVALIR       420
     AQKALDSLKG DNDDQNMGIN ILRRAIESPM RQIVTNAGYE ASVVVNKVAE HKDNYGFNAA       480
     TGEYGDMVEM GILDPTKVTR MALQNAASVA SLMLTTECMV ADLPKKEEGV GAGDMGGMGG       540
     MGGMGGMM                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page