(data stored in ACNUC7421 zone)

EMBL: CP000675.HTPX

CP000675.HTPX        Location/Qualifiers
FT   CDS             complement(273310..274152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPC_0264"
FT                   /product="heat shock protein, protease HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54260"
FT                   /db_xref="GOA:A5IA60"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA60"
FT                   /protein_id="ABQ54260.1"
FT                   /translation="MINNLKTFILLASLTALLVVIGGLLGGSTGMLVALLFAGIMNFSA
FT                   YWYSDTLVLKMYNAEPLSNNHFVYHIVSELAHRAGTSVPKVYLINNSTPNAFATGRNPE
FT                   NASIAVTTGLLDRLTQEEITGVLAHELAHVIHRDTLINVVSATIAGAISGIANMFMWLS
FT                   MFGHNSNNEEGVHPVVGMIMMIVAPLAAGLIQMAISRSREFEADAGGARISGNPQWLAS
FT                   ALLKLDQANHEQYFDEAETHPATAHLFIINPLNGEKLANLFSTHPSTAERVARLRAMY"
     MINNLKTFIL LASLTALLVV IGGLLGGSTG MLVALLFAGI MNFSAYWYSD TLVLKMYNAE        60
     PLSNNHFVYH IVSELAHRAG TSVPKVYLIN NSTPNAFATG RNPENASIAV TTGLLDRLTQ       120
     EEITGVLAHE LAHVIHRDTL INVVSATIAG AISGIANMFM WLSMFGHNSN NEEGVHPVVG       180
     MIMMIVAPLA AGLIQMAISR SREFEADAGG ARISGNPQWL ASALLKLDQA NHEQYFDEAE       240
     THPATAHLFI INPLNGEKLA NLFSTHPSTA ERVARLRAMY                             280
//

If you have problems or comments...

PBIL Back to PBIL home page