(data stored in ACNUC7421 zone)

EMBL: CP000675.LIDJ

CP000675.LIDJ        Location/Qualifiers
FT   CDS             complement(500177..500725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lidJ"
FT                   /locus_tag="LPC_2936"
FT                   /product="inner (transmembrane) protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2936"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56837"
FT                   /protein_id="ABQ56837.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFVAVGLCFVMNLMLGIRASHYGLMLLASLLGLSISVRQMYIHLTPGDPGYGGLFLGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGFMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
     MNKQMQWHLF GNTSGLLIIC CLLILAFLDQ FIFYELPCPI CILQRICFVA VGLCFVMNLM        60
     LGIRASHYGL MLLASLLGLS ISVRQMYIHL TPGDPGYGGL FLGLHLYTWS AIIFLVIILL       120
     IAGALILDKG FMPDYKVRSK SAKVMIWVFF ILILANGIST FLECGPHECP DNPSKYYLLN       180
     NN                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page