(data stored in ACNUC7421 zone)

EMBL: CP000675.MHPC

CP000675.MHPC        Location/Qualifiers
FT   CDS             334851..335645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="LPC_0313"
FT                   /product="lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54308"
FT                   /protein_id="ABQ54308.1"
FT                   /translation="MATLKIHDVDIYYELYGQGKPLVLIAGYCCDHTFWNAMLHELAEE
FT                   FQVLIFDNRGIGQTRDNGDSFTLEAQADDIMAFLEQLGFRNPSILGQSMGGAIAQLLAR
FT                   KHGKKISKLVILNSVAKFNTRANQAMESLLNLRKENISFDLLIEAGIPWFFSSEYLAEP
FT                   KNIATFKENLKNNPYPQSLQDQVRQFRSIPPFDSRGWLHEIKVPTLVIAAEDDILTLPA
FT                   ESQQLAQRIPNAQFITIPGGHSSPLEHPALVNDAILKFLTSS"
     MATLKIHDVD IYYELYGQGK PLVLIAGYCC DHTFWNAMLH ELAEEFQVLI FDNRGIGQTR        60
     DNGDSFTLEA QADDIMAFLE QLGFRNPSIL GQSMGGAIAQ LLARKHGKKI SKLVILNSVA       120
     KFNTRANQAM ESLLNLRKEN ISFDLLIEAG IPWFFSSEYL AEPKNIATFK ENLKNNPYPQ       180
     SLQDQVRQFR SIPPFDSRGW LHEIKVPTLV IAAEDDILTL PAESQQLAQR IPNAQFITIP       240
     GGHSSPLEHP ALVNDAILKF LTSS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page