(data stored in ACNUC7421 zone)

EMBL: CP000675.NDH

CP000675.NDH         Location/Qualifiers
FT   CDS             830819..833035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="LPC_2622"
FT                   /product="NADH dehydrogenase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56537"
FT                   /protein_id="ABQ56537.1"
FT                   /translation="MQQEDRAPITQKNRSFSRNTARCFDTFMDTVDFLGRIGWPVIDLA
FT                   FRIWIAQQLLVSAILLTNHWDTAVYLAKNEYPVPWLSPEWEALLGILAQFVGGISLLLG
FT                   LFTRCGAAVIIGFAVMTQVYYQPIDLNLLWIALMLGYVLRGPGPLSLDNLFEHGFSRSP
FT                   LPFAMLIVTFVDRTREFFSSLYLFSLRMWLMISLLLINQHIQLISSDALPLLMPWLPLN
FT                   SASIVFNNVSLFMAIFLGLGLATRVVAIFGLIVVLLSFTPGVTGFYLYWMVVMAILFIS
FT                   GPGILSLDHLIFHALKKHYPQLSGKPAFSLDGLPRVVIIGAGFGGIACAKALRHMPVKI
FT                   TLIDRHNYHLFQPFLYQIATGSLSPADIAISIRSIFLEQFNAEILLGNVTDINKEERLV
FT                   IADNFTIPYDYLVIATGATHSYFGKDSWAPYAPGLKTINDGTSVRSRIIKSFELAEIAE
FT                   SDEERKQFLNFVIVGAGPTGVELAGAIAELARFGIVKEFRHFDPASANIILVQAAPRIL
FT                   PTFSEQISQKAQRYLESMGVKVLVNSMVEQIDSDGVIINKERIYSKSVFWAAGVAASPA
FT                   SKWLQLEADPAGRVKVNDDLTVAGYSNIFAIGDTAASNAWNGKPVPGIAPAAKQGGAYV
FT                   AKVISKRIYNNNSRYKPFKYIHYGSLATVGRKAAVAEFDRFKISGELAWWFWGGVHVFF
FT                   LVGSRNRLSVILNWLWSYYTFRANNLLITDDSLNKKNKSGTSEV"
     MQQEDRAPIT QKNRSFSRNT ARCFDTFMDT VDFLGRIGWP VIDLAFRIWI AQQLLVSAIL        60
     LTNHWDTAVY LAKNEYPVPW LSPEWEALLG ILAQFVGGIS LLLGLFTRCG AAVIIGFAVM       120
     TQVYYQPIDL NLLWIALMLG YVLRGPGPLS LDNLFEHGFS RSPLPFAMLI VTFVDRTREF       180
     FSSLYLFSLR MWLMISLLLI NQHIQLISSD ALPLLMPWLP LNSASIVFNN VSLFMAIFLG       240
     LGLATRVVAI FGLIVVLLSF TPGVTGFYLY WMVVMAILFI SGPGILSLDH LIFHALKKHY       300
     PQLSGKPAFS LDGLPRVVII GAGFGGIACA KALRHMPVKI TLIDRHNYHL FQPFLYQIAT       360
     GSLSPADIAI SIRSIFLEQF NAEILLGNVT DINKEERLVI ADNFTIPYDY LVIATGATHS       420
     YFGKDSWAPY APGLKTINDG TSVRSRIIKS FELAEIAESD EERKQFLNFV IVGAGPTGVE       480
     LAGAIAELAR FGIVKEFRHF DPASANIILV QAAPRILPTF SEQISQKAQR YLESMGVKVL       540
     VNSMVEQIDS DGVIINKERI YSKSVFWAAG VAASPASKWL QLEADPAGRV KVNDDLTVAG       600
     YSNIFAIGDT AASNAWNGKP VPGIAPAAKQ GGAYVAKVIS KRIYNNNSRY KPFKYIHYGS       660
     LATVGRKAAV AEFDRFKISG ELAWWFWGGV HVFFLVGSRN RLSVILNWLW SYYTFRANNL       720
     LITDDSLNKK NKSGTSEV                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page