(data stored in ACNUC7421 zone)

EMBL: CP000675.OSMY

CP000675.OSMY        Location/Qualifiers
FT   CDS             complement(477976..478527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="LPC_2961"
FT                   /product="osmotically inducible protein Y"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2961"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56862"
FT                   /protein_id="ABQ56862.1"
FT                   /translation="MPKCMHFILATALIFVTSTFYASNLREIEQEVSDSVITAKITAKF
FT                   AESRHLNPLKISIDTEKGIVTLSGYAPDKQAFIDALQIAKNTKGVKAVHAKDLHIKKVN
FT                   TAFTDAFITAEVETAVLKAKILDDESIPLVGINASTTNGEVTLSGHVKSARSIAAIIKR
FT                   VNEIPGVKKIVTNLEIQENA"
     MPKCMHFILA TALIFVTSTF YASNLREIEQ EVSDSVITAK ITAKFAESRH LNPLKISIDT        60
     EKGIVTLSGY APDKQAFIDA LQIAKNTKGV KAVHAKDLHI KKVNTAFTDA FITAEVETAV       120
     LKAKILDDES IPLVGINAST TNGEVTLSGH VKSARSIAAI IKRVNEIPGV KKIVTNLEIQ       180
     ENA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page