(data stored in ACNUC7421 zone)

EMBL: CP000675.OSTA

CP000675.OSTA        Location/Qualifiers
FT   CDS             407333..409987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="LPC_0376"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54371"
FT                   /protein_id="ABQ54371.1"
FT                   /translation="MRFYKKLIISGFISFIALLRGLLYCHLKRLFKKWPGSLFSVKWVL
FT                   MAIGITACVLSLINYQGLAYSAALINEPIQACVIAREVDLTDDIRTKFAQCLGWQADQS
FT                   SPVCLGFYKPITVTPLASPDEVRILADTASFYRTQRSTLSGHVEMQQGQRVVNAQTAYV
FT                   YRDPKTNEVTKIEFLNHVRYLEPDRMMIARKAVVYPQDKSGEVEDVLYRFNTNRSNALL
FT                   PAWGRASLIKRFANQDYFLKEATYTTCAPQDKAWAIEAESISIDNEKGKGIARNAKLRI
FT                   HEWPVLYTPYLSFPTNRDRKSGFLMPIVGYSNVGGADLGIPYYWNMAPNYDMTLVPHLY
FT                   TKRGLMLGGQFRYLTSKSTGTFNGNFLPKDKAFGRFLQDNEVEFPQIRGLSTNRWEVNF
FT                   VDSTQFLSDLQLNVNFQQVSDDYYLQDFSTNLASVTQRQLLRQADLTYTTENWTFRGMG
FT                   QSYQTLHPINEIPVSPVYERLPQLMARGYYDDLPFNAQFNILGQYDQFHWPNDSWNIAL
FT                   NNMPQGPRFHLNPILSVPMMKPWGYVTPSVQFVENYYDISRNYTWGTSRANYNLTIPRY
FT                   SLDGGLYFERDLHLKGTYYIQTLEPRLFYLRVPYYNQTLIPVYDSGFMIFNVDQLFRTN
FT                   RFSGFDRIGDANQLSYALTTRWLEDESGAEKANFSIGQIKYFSERRVQLCQSPTGFCTD
FT                   NPDTFGNLSSTFGTSPVASRAVYKFNPAWGITGDYIWDPATRATNNADLNLHYQPARNA
FT                   IINGGYSYLVNGDVTQVRNNDTENNALHQAILSAAWPLSEKWSGIGAYSYNISKNYSMM
FT                   SFLGVQYDSCCWAMRILGGRTFRSLNEEFEPQYNNNIYLQILLKGLGSVANSDPSGILN
FT                   TYIPGYYDPFRRR"
     MRFYKKLIIS GFISFIALLR GLLYCHLKRL FKKWPGSLFS VKWVLMAIGI TACVLSLINY        60
     QGLAYSAALI NEPIQACVIA REVDLTDDIR TKFAQCLGWQ ADQSSPVCLG FYKPITVTPL       120
     ASPDEVRILA DTASFYRTQR STLSGHVEMQ QGQRVVNAQT AYVYRDPKTN EVTKIEFLNH       180
     VRYLEPDRMM IARKAVVYPQ DKSGEVEDVL YRFNTNRSNA LLPAWGRASL IKRFANQDYF       240
     LKEATYTTCA PQDKAWAIEA ESISIDNEKG KGIARNAKLR IHEWPVLYTP YLSFPTNRDR       300
     KSGFLMPIVG YSNVGGADLG IPYYWNMAPN YDMTLVPHLY TKRGLMLGGQ FRYLTSKSTG       360
     TFNGNFLPKD KAFGRFLQDN EVEFPQIRGL STNRWEVNFV DSTQFLSDLQ LNVNFQQVSD       420
     DYYLQDFSTN LASVTQRQLL RQADLTYTTE NWTFRGMGQS YQTLHPINEI PVSPVYERLP       480
     QLMARGYYDD LPFNAQFNIL GQYDQFHWPN DSWNIALNNM PQGPRFHLNP ILSVPMMKPW       540
     GYVTPSVQFV ENYYDISRNY TWGTSRANYN LTIPRYSLDG GLYFERDLHL KGTYYIQTLE       600
     PRLFYLRVPY YNQTLIPVYD SGFMIFNVDQ LFRTNRFSGF DRIGDANQLS YALTTRWLED       660
     ESGAEKANFS IGQIKYFSER RVQLCQSPTG FCTDNPDTFG NLSSTFGTSP VASRAVYKFN       720
     PAWGITGDYI WDPATRATNN ADLNLHYQPA RNAIINGGYS YLVNGDVTQV RNNDTENNAL       780
     HQAILSAAWP LSEKWSGIGA YSYNISKNYS MMSFLGVQYD SCCWAMRILG GRTFRSLNEE       840
     FEPQYNNNIY LQILLKGLGS VANSDPSGIL NTYIPGYYDP FRRR                        884
//

If you have problems or comments...

PBIL Back to PBIL home page