(data stored in ACNUC7421 zone)

EMBL: CP000675.PCM

CP000675.PCM         Location/Qualifiers
FT   CDS             complement(874011..874661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="LPC_2594"
FT                   /product="protein-L-isoaspartate-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56509"
FT                   /protein_id="ABQ56509.1"
FT                   /translation="MNHSARINMIKQQLRTGDVLNESILDLYDEILRHEFVPEPFSHFA
FT                   YSDMQIPLAHGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISI
FT                   DYYSEFTTNAKRKLEEHNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQI
FT                   LPGGKLFAILGKSPVMKAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF"
     MNHSARINMI KQQLRTGDVL NESILDLYDE ILRHEFVPEP FSHFAYSDMQ IPLAHGQRML        60
     TPLEEGTILQ SLDLKGHETV LEVGTGTGFM TALLSKLCKK VISIDYYSEF TTNAKRKLEE       120
     HNCNNVELIT GDACRGWLES APYDVIVFTG AMEKLTDTHK LQILPGGKLF AILGKSPVMK       180
     AYLFQLDHNA IWTESMLFET DIPPLVDQLK PKEFVF                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page