(data stored in ACNUC7421 zone)

EMBL: CP000675.PE101

CP000675.PE101       Location/Qualifiers
FT   CDS             complement(100651..101598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0102"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54101"
FT                   /protein_id="ABQ54101.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKENGKESTLDKVNFCRKEFAR"
     MINLFRRLKN HGVLSINQRN TDFVLRYNPR KLFPLVDDKL KTKKLALKAG IAVPALYDII        60
     ETEQQIKSIE TRFASYNDFV VKPARGSGGD GILVFKDKVY GRYRQINGKL TTVQELSYHL       120
     SCLLSGAYSL GGSSDYAIIE KRVVVDPVFA EVSYEGIPDI RIITLLGYPA MAMVRLPTRL       180
     SGGKANLHQG AIGVGVDLAT GKTLGGVFQN DTIDYHPDTL NPIVGIEVPY WNQILEIASS       240
     CYELTGLGYL GVDIVLDKEH GPLMLELNAR PGLNIQIANR EGGLKRYRTI EARFKENGKE       300
     STLDKVNFCR KEFAR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page