(data stored in ACNUC7421 zone)

EMBL: CP000675.PE102

CP000675.PE102       Location/Qualifiers
FT   CDS             complement(101595..103118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54102"
FT                   /protein_id="ABQ54102.1"
FT                   /translation="MKNNKRHVYGLILTLLLLGSGIFLYRHIILDVPLTDTETINSWMV
FT                   ESNLRFTADRNTPIKASFNIPYLPPNFAILDEYFVSRNYGVTTNLNGSNRETVWSIRRG
FT                   NGPQSLYYRAIFRQTDSDESSLPKPSVTKSQPLNDSQKSAVETITNQVRSTSADIQTFA
FT                   QSTIKELNKRDGNAKLLVGNEFNDDNIINATILILNQSKIPAITVQGIYLNQQKKADLK
FT                   SLLAVFNGKNWIYINPKTGSAGLPKEFLIWQYGNGPLFNVVGGNRAQFSLTVSPTPINA
FT                   LSVAKSRGLEDSQLLRFSLLQLPVNVQGIYKILLTVPIGAFIILILRNFIGIKTFGTFM
FT                   PVLIALAFRETHVAWGITLFVIIISFGLLARFYLDQLRLLLVPRLAAILTVVILLMIFI
FT                   SVLCQNLSLDTGMSVALFPMVILTMTIERMCITWDERGASEAIKSGIGSLAAAVISYGA
FT                   MSYEPLQYLIFAFPELLLVLLSLILWFGQYRGYRLVELKRFKSLASAMK"
     MKNNKRHVYG LILTLLLLGS GIFLYRHIIL DVPLTDTETI NSWMVESNLR FTADRNTPIK        60
     ASFNIPYLPP NFAILDEYFV SRNYGVTTNL NGSNRETVWS IRRGNGPQSL YYRAIFRQTD       120
     SDESSLPKPS VTKSQPLNDS QKSAVETITN QVRSTSADIQ TFAQSTIKEL NKRDGNAKLL       180
     VGNEFNDDNI INATILILNQ SKIPAITVQG IYLNQQKKAD LKSLLAVFNG KNWIYINPKT       240
     GSAGLPKEFL IWQYGNGPLF NVVGGNRAQF SLTVSPTPIN ALSVAKSRGL EDSQLLRFSL       300
     LQLPVNVQGI YKILLTVPIG AFIILILRNF IGIKTFGTFM PVLIALAFRE THVAWGITLF       360
     VIIISFGLLA RFYLDQLRLL LVPRLAAILT VVILLMIFIS VLCQNLSLDT GMSVALFPMV       420
     ILTMTIERMC ITWDERGASE AIKSGIGSLA AAVISYGAMS YEPLQYLIFA FPELLLVLLS       480
     LILWFGQYRG YRLVELKRFK SLASAMK                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page