(data stored in ACNUC7421 zone)

EMBL: CP000675.PE103

CP000675.PE103       Location/Qualifiers
FT   CDS             complement(103108..103581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0104"
FT                   /product="conserved hypothetical protein; DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54103"
FT                   /protein_id="ABQ54103.1"
FT                   /translation="MANSEAQIYGYVEEATLIDQNLTLSAKLDTGAKSASLHAVNITEI
FT                   EKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRSSETNPGLLRTTPIKRPVVLLNIKL
FT                   GDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVDPALTFTTKSKSPVNNEK"
     MANSEAQIYG YVEEATLIDQ NLTLSAKLDT GAKSASLHAV NITEIEKKGI PYLRFTVPTK        60
     TGDYSFEGEY VGKVKIKVRS SETNPGLLRT TPIKRPVVLL NIKLGDKVRT IKVNLTNRKR       120
     FLYPLLLGRD AIIDFNGAVD PALTFTTKSK SPVNNEK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page