(data stored in ACNUC7421 zone)

EMBL: CP000675.PE105

CP000675.PE105       Location/Qualifiers
FT   CDS             complement(105782..106372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54105"
FT                   /protein_id="ABQ54105.1"
FT                   /translation="MQESFDPSTITTLHKTSIIRWKANGIEYQHKQFLQLVEENHAFNF
FT                   QLWHAEDKARRNDMGFEFVYQAKREIDAFNQQRNNRMEAMDEWLYKALQPENHNHCPVN
FT                   SESPGMIIDRLSILSLKSYHMDLQTKRQDVGVEHRIACTQKLEIIQQQLNQLALCLDEL
FT                   LNEVRAKTRTFRVYHQFKMYNDPKLNPELYCSD"
     MQESFDPSTI TTLHKTSIIR WKANGIEYQH KQFLQLVEEN HAFNFQLWHA EDKARRNDMG        60
     FEFVYQAKRE IDAFNQQRNN RMEAMDEWLY KALQPENHNH CPVNSESPGM IIDRLSILSL       120
     KSYHMDLQTK RQDVGVEHRI ACTQKLEIIQ QQLNQLALCL DELLNEVRAK TRTFRVYHQF       180
     KMYNDPKLNP ELYCSD                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page