(data stored in ACNUC7421 zone)

EMBL: CP000675.PE107

CP000675.PE107       Location/Qualifiers
FT   CDS             complement(107419..107865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0108"
FT                   /product="conserved hypothetical protein; DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54107"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9Q7"
FT                   /protein_id="ABQ54107.1"
FT                   /translation="MTIWVDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAKEKTNFANALDRWLVKSK"
     MTIWVDADAC PKMIKDILFR AAIRTNTNLI LVANSYLTYP NSPFIRSVLV EKGYDRADHY        60
     ITSHMKAKDL VITADIPLAA EVIVKQGLAM SPRGELFTAN NIKQRLTLRD INEQLRSAGE       120
     RTGGPSALSA KEKTNFANAL DRWLVKSK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page