(data stored in ACNUC7421 zone)

EMBL: CP000675.PE108

CP000675.PE108       Location/Qualifiers
FT   CDS             107976..111950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54108"
FT                   /protein_id="ABQ54108.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQTPA
FT                   QKNQFSHNQSVPFGLPASLSVLAIVLTYAPNLLHRELSEQLLTMLDSIRETETSVDNQL
FT                   AERCTEQLNYYSDAKPVLIALKERGAKDLIQILEQADERSLLAFSHLAKDTDLNVLIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLIDGSINALSIRLLLSLISSVKA
FT                   IEKLKAARACLAQYPFSIDLHAMRAVFDFYQYELKRDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIEYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGKI
FT                   RTKINQLDPYLFDTPQLYQLASDLITKSCNSGKESLSSSPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLLIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLHQMECLLEANKGGEELNNKGLEVLYHYYALSYPNLRSDLFLK
FT                   VVNHIYSRFFIKGNNETEARDGLFHWLKQNFPLIDKLPKDLDRKKEIFLYNSAGKKIGF
FT                   LGESNAAMTFVNEEIVLLAQTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENSIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGVIRNKNNALELFHYILNRDSRCSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISRDKKQETICDAVLDRLISSEACAALVLKEFLGDRTHNSIQRVNNPEIGKVSQFFDRR
FT                   HIVSLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNPDSPQVWQGKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANSGITSLFYKQKTLNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWNKRD
FT                   KQKKSPIICTYLLSYTGRKSVLSRLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQLLDRQILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLVSAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNAEN
FT                   SSSKIIKFCDDPTPGPTRKKAGDLINAPVAESRTNSLYLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQPKQSIDYNTPAIPSSFESIM"
     MKQLISIIKG QIQQLPIPDL KHLLLSHLKE DAHDLTELFC QQTPAQKNQF SHNQSVPFGL        60
     PASLSVLAIV LTYAPNLLHR ELSEQLLTML DSIRETETSV DNQLAERCTE QLNYYSDAKP       120
     VLIALKERGA KDLIQILEQA DERSLLAFSH LAKDTDLNVL IETFLVKNNK DLDLVNRNHL       180
     VQFLRQPDLA GWLTRFLDSL IDGSINALSI RLLLSLISSV KAIEKLKAAR ACLAQYPFSI       240
     DLHAMRAVFD FYQYELKRDL FSPESHLVMQ LLHDLLKNTK LDKQQEFFQG LSQETVLLII       300
     EYCIAEYNKT TGEEKQNCKN LLTRLCSAFS DSSQDFLGKI RTKINQLDPY LFDTPQLYQL       360
     ASDLITKSCN SGKESLSSSP IALLLSMPQF VGVCTPKVLK QLVERYSLYT LTLNQKDYKQ       420
     DLCFKEYAPY FDEINEHMAQ IERNLLIHPE AQSFWLDKKY SLLQFRVEIS KSALLHQMEC       480
     LLEANKGGEE LNNKGLEVLY HYYALSYPNL RSDLFLKVVN HIYSRFFIKG NNETEARDGL       540
     FHWLKQNFPL IDKLPKDLDR KKEIFLYNSA GKKIGFLGES NAAMTFVNEE IVLLAQTGSM       600
     DINEPLYDQE GLVLGYLTEE SCLRSESAIH KNAAAWVLAG LSKSDLESSS FGLESLLHNV       660
     LFENSIGVLY QCESICLDAN KRIWLNNKLL KEIQEAPGEI PASVLYPLLD HFEDETVFEL       720
     LGVIRNKNNA LELFHYILNR DSRCSILLNG LYESDFQRFL EHQGADVCLA DYLVNYYDKP       780
     WFSEVLLRFA YHGKKYKKPD LLSSALTFIT KEISRDKKQE TICDAVLDRL ISSEACAALV       840
     LKEFLGDRTH NSIQRVNNPE IGKVSQFFDR RHIVSLIAQL NKTSYWEQNA QYKLALHILA       900
     NQHGRLFSET DLNPDSPQVW QGKELKELAC FTSRHLSKKR PFDNKHDIGY RVLGELLFRC       960
     ANSGITSLFY KQKTLNRAIT RLSITEPFLV RMVDKLWMPK GIRELYGKSL FFKGSWFDDQ      1020
     VFLQKELKDH HPLLDWSHFI KQTWNKRDKQ KKSPIICTYL LSYTGRKSVL SRLLQDYFNS      1080
     FQGMPDYIRP VSQLLRFFPQ RDVSAVIYDA LEAEMIKKPQ LLDRQILSDM AFYYGKQLAR      1140
     KDTSFPQADI NLLTYWGQNK HYSLVKRGCE LLVRDCEDKG VKKRLVSAAK EAEVEQDLSS      1200
     SVQTFYFGLI KFFKRLWHYG FNAENSSSKI IKFCDDPTPG PTRKKAGDLI NAPVAESRTN      1260
     SLYLGFSERR KQLISLLATI KSSPAHFTRV VNYSDNTQTF FGEQPKQSID YNTPAIPSSF      1320
     ESIM                                                                   1324
//

If you have problems or comments...

PBIL Back to PBIL home page