(data stored in ACNUC7421 zone)

EMBL: CP000675.PE109

CP000675.PE109       Location/Qualifiers
FT   CDS             112168..112632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0110"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54109"
FT                   /protein_id="ABQ54109.1"
FT                   /translation="MRILLSFFLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNVTNLDLWITHPVTDPGASAGWTSRLQAGKWSALVVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPASNQGTFWVAEDLSLAALNAAVGGRGFVLPEK"
     MRILLSFFLL LLSTGLFAES TFPDGCRAVP VQGQSVTLKA KKNKLVFIHN VTNLDLWITH        60
     PVTDPGASAG WTSRLQAGKW SALVVDKPAF ILNCIESRPG HEQQIPCENA IAVCQWKGVK       120
     IPASNQGTFW VAEDLSLAAL NAAVGGRGFV LPEK                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page