(data stored in ACNUC7421 zone)

EMBL: CP000675.PE115

CP000675.PE115       Location/Qualifiers
FT   CDS             119775..120116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0116"
FT                   /product="alkylphosphonate uptake protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54115"
FT                   /protein_id="ABQ54115.1"
FT                   /translation="MNQLPNCPKCLSEYCYEDGDVLICPECTHEWPRNSNNNDEESAKI
FT                   IKDANGNLLQNGDTITVVKDLKIKGSSQVIKVGTKVKNIRLVDGDHDIDCRIDGIGAMK
FT                   LKSQFVKKI"
     MNQLPNCPKC LSEYCYEDGD VLICPECTHE WPRNSNNNDE ESAKIIKDAN GNLLQNGDTI        60
     TVVKDLKIKG SSQVIKVGTK VKNIRLVDGD HDIDCRIDGI GAMKLKSQFV KKI              113
//

If you have problems or comments...

PBIL Back to PBIL home page