(data stored in ACNUC7421 zone)

EMBL: CP000675.PE116

CP000675.PE116       Location/Qualifiers
FT   CDS             120231..120683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0117"
FT                   /product="two component sensor and regulator, histidine
FT                   kinase response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54116"
FT                   /protein_id="ABQ54116.1"
FT                   /translation="MRVLIVEDSAFNAFCLRRLLESVVASISVTIVNNSQAALSFVNNY
FT                   CPDIVVVDGDLGASPDEMNCNGPELAGILLQKYPQLPIVAWSDSDAMREDFIKVFKSRG
FT                   LFLNEYNTWPKVIGLERIHKTWSYYFGEFIGGQNPSFASQTSINYY"
     MRVLIVEDSA FNAFCLRRLL ESVVASISVT IVNNSQAALS FVNNYCPDIV VVDGDLGASP        60
     DEMNCNGPEL AGILLQKYPQ LPIVAWSDSD AMREDFIKVF KSRGLFLNEY NTWPKVIGLE       120
     RIHKTWSYYF GEFIGGQNPS FASQTSINYY                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page