(data stored in ACNUC7421 zone)

EMBL: CP000675.PE122

CP000675.PE122       Location/Qualifiers
FT   CDS             complement(127823..128413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0123"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54122"
FT                   /protein_id="ABQ54122.1"
FT                   /translation="MLRILLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGDTLKNPTYEQVSAGNTHYAESVMVEFDPNKLSYKKLVEYFFMHIDPTVKNA
FT                   QFCDQGRQYRSAIFYMNDQQKKIAMEYKKELEQKFPTIYTEIVPSTSFYPAEEYHQNYY
FT                   KKNPIRYKYYRYRCGRDARVQEVWGNKKQENNS"
     MLRILLYFLL LINTTFCLAK TEKAIFAGGC FWCMEADFDH LPGVLSTTSG FDGDTLKNPT        60
     YEQVSAGNTH YAESVMVEFD PNKLSYKKLV EYFFMHIDPT VKNAQFCDQG RQYRSAIFYM       120
     NDQQKKIAME YKKELEQKFP TIYTEIVPST SFYPAEEYHQ NYYKKNPIRY KYYRYRCGRD       180
     ARVQEVWGNK KQENNS                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page