(data stored in ACNUC7421 zone)

EMBL: CP000675.PE123

CP000675.PE123       Location/Qualifiers
FT   CDS             complement(128521..129117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0124"
FT                   /product="cytochrome oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54123"
FT                   /protein_id="ABQ54123.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   ILLDKPYIAISFLLLSGYLDTLDGSLARFQNRASDFGSAMDIVMDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSSHFNFLAALFCFLVCLTALIRLFEFKKSVQAPG"
     MLEQSLRHYY QLVLVDPILP ALRDRITPLS ITWLSGIFGL LFIPFILLDK PYIAISFLLL        60
     SGYLDTLDGS LARFQNRASD FGSAMDIVMD RIVEFSAVLA LYLFDPQHRA TLAILMLGSI       120
     LLCITSFLVV GIFSNNTTQK SFYYSPGIME RAEAFLFFIF MTLFSSHFNF LAALFCFLVC       180
     LTALIRLFEF KKSVQAPG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page