(data stored in ACNUC7421 zone)

EMBL: CP000675.PE127

CP000675.PE127       Location/Qualifiers
FT   CDS             132521..134323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54127"
FT                   /protein_id="ABQ54127.1"
FT                   /translation="MIQLGDLLKPTWAAEQSLNNAWSVLNDEEKETIKSRMEKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFAQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSIKHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIELKNCHEMTMTELAQHIQHDMRI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHERVYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWNKINNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDNFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
     MIQLGDLLKP TWAAEQSLNN AWSVLNDEEK ETIKSRMEKI FYNEIPFQLE HDKLIYIHLF        60
     SLFAQLETIG LRGLIKSLEK LRGTDLYQQM RQQITDEIFH ATVFAKVAFQ LSAPYALPLG       120
     HQKSIKHFIS SLEGEEDLAT SITLVNLVGE GWVEELCIAM KEKNIAVTIF ETVLEDESRH       180
     MDEYDLYRQI GLPNKDYLRK KLAIFEDELI NTVFAHEQYL TTLGILLGKE GALKLLNNIN       240
     NKHHWMLKKI GLTPSAHWQL FMDTMPLLMK NLSHDFEKDK AIEPTNIRKL LSAIWNDPEL       300
     PTESAIFNIN VTPVCFFEKK FKPETITCLM LQALSKACFD NPQTRNYIFN HKLYHSHNSY       360
     VALAVKIPGS DQLGAIELKN CHEMTMTELA QHIQHDMRIM KYCYEKTQSL QKEHPYLIEV       420
     VNRLLTPRHE RVYRDFLFAR PAISLSNIGH WGYQAAVSPL FPNETFKITL TEIERKQVWN       480
     KINNTFEVQD VLPVGMSVDH RVFDGNIPFP RYMQEAFDQM FQDMEQSRIK PLSKPFSNLD       540
     NFIKYSNTLL ENDLEFGFLY LFSLMHVWKN YISYDELSKT VEENYERIKQ ALSKSEHQLG       600
//

If you have problems or comments...

PBIL Back to PBIL home page