(data stored in ACNUC7421 zone)

EMBL: CP000675.PE130

CP000675.PE130       Location/Qualifiers
FT   CDS             complement(135665..138934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54130"
FT                   /protein_id="ABQ54130.1"
FT                   /translation="MFIYNSWNVKFILLFQIMIIRELFNWIHNDSATLHLSDQTIERDL
FT                   IEQEESQAKQAHRVLLGNARLLKYSGSSNTEAIKELEQHCLFMDYLQLYKQEFVKDRKN
FT                   TVFLIALKNLLSHPHEEQLRLMPKINELFQILLRDNKESALSFYDKNKELFRHCTEIQE
FT                   RVTFELLQQKIEADSKLVMTQLDYFNEHLAYQENPLGIIALCRNWIGETEKFTALILWL
FT                   LERKVSVEKILLTNLLQDFLKYHLFTLHSKDSEVSRLYSLLGHFPEAQELVMAAQKISC
FT                   GELMFQQYSLDGIFRGKNLPVVSPEIPPLQFSLRKDNFNALYRTFGQYFLTAGVATATN
FT                   HSDVAWLDMLRHTLNQPETLKLLPDIINIIAREYSPKVLKTLAELIAESTAHRLLTLNQ
FT                   SCVFHLLQHKPRLLHDITEENVIEYINLLVRLDTHDQEIIYQLMALFRVLLKKNHPATK
FT                   AVFEAILDNLVNHPQLLEDEEFLIQLKKYPDCELLIEERCENILKQLNFCIAEQTSGLL
FT                   FGKHNYYIIEDVWLGALRKFAVLQQINPQMKSSFGHKYALQARIAEVVFIHQGDLFDLD
FT                   TFIDALDLPPVTSSGEISLYERALIEILATIDNELIRKQIIQKLETTPFNRLDWYEREY
FT                   GNQTVFIKAAKKGNLGLINLLEDKMKPSVLNKALRVAAKNYQWETLAHLCSLPEVELSQ
FT                   EEMDDLVAHLAKHGRVENIKKLLKLYDYKPSTELISAILKKGIENDNLQVVMYFCKLPV
FT                   ESPKQAILDRLFKLAIQLQHWDIVKFLANSKHYSPSQTTLEKAFQQTALAMQHEAVEIL
FT                   GNVEKTPVRAIVIERALLKASKLGHTNIVQSICSLPSEVLTKRAIEDALEQAAAQGHLD
FT                   IVSCLCEPGNTALRPPGINSGMKIAVQAGKLSLVNYFCSMTGSNKPTPRLIDQTLVMAV
FT                   KKGQTAIFMAIHSNRQTPPGKHAIEQSFQLAITGGKLQILDYLCRHERYGLNQSKIDQA
FT                   LISAVKSKQLEIVSYLCESLEITPSRKALRIAVTKAISSDQNDLADYLRSCSSGKSKPV
FT                   DTPIDEIDSPCEIGKQLATNGLFKYKRKDDKGPPLLLNPSL"
     MFIYNSWNVK FILLFQIMII RELFNWIHND SATLHLSDQT IERDLIEQEE SQAKQAHRVL        60
     LGNARLLKYS GSSNTEAIKE LEQHCLFMDY LQLYKQEFVK DRKNTVFLIA LKNLLSHPHE       120
     EQLRLMPKIN ELFQILLRDN KESALSFYDK NKELFRHCTE IQERVTFELL QQKIEADSKL       180
     VMTQLDYFNE HLAYQENPLG IIALCRNWIG ETEKFTALIL WLLERKVSVE KILLTNLLQD       240
     FLKYHLFTLH SKDSEVSRLY SLLGHFPEAQ ELVMAAQKIS CGELMFQQYS LDGIFRGKNL       300
     PVVSPEIPPL QFSLRKDNFN ALYRTFGQYF LTAGVATATN HSDVAWLDML RHTLNQPETL       360
     KLLPDIINII AREYSPKVLK TLAELIAEST AHRLLTLNQS CVFHLLQHKP RLLHDITEEN       420
     VIEYINLLVR LDTHDQEIIY QLMALFRVLL KKNHPATKAV FEAILDNLVN HPQLLEDEEF       480
     LIQLKKYPDC ELLIEERCEN ILKQLNFCIA EQTSGLLFGK HNYYIIEDVW LGALRKFAVL       540
     QQINPQMKSS FGHKYALQAR IAEVVFIHQG DLFDLDTFID ALDLPPVTSS GEISLYERAL       600
     IEILATIDNE LIRKQIIQKL ETTPFNRLDW YEREYGNQTV FIKAAKKGNL GLINLLEDKM       660
     KPSVLNKALR VAAKNYQWET LAHLCSLPEV ELSQEEMDDL VAHLAKHGRV ENIKKLLKLY       720
     DYKPSTELIS AILKKGIEND NLQVVMYFCK LPVESPKQAI LDRLFKLAIQ LQHWDIVKFL       780
     ANSKHYSPSQ TTLEKAFQQT ALAMQHEAVE ILGNVEKTPV RAIVIERALL KASKLGHTNI       840
     VQSICSLPSE VLTKRAIEDA LEQAAAQGHL DIVSCLCEPG NTALRPPGIN SGMKIAVQAG       900
     KLSLVNYFCS MTGSNKPTPR LIDQTLVMAV KKGQTAIFMA IHSNRQTPPG KHAIEQSFQL       960
     AITGGKLQIL DYLCRHERYG LNQSKIDQAL ISAVKSKQLE IVSYLCESLE ITPSRKALRI      1020
     AVTKAISSDQ NDLADYLRSC SSGKSKPVDT PIDEIDSPCE IGKQLATNGL FKYKRKDDKG      1080
     PPLLLNPSL                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page