(data stored in ACNUC7421 zone)

EMBL: CP000675.PE131

CP000675.PE131       Location/Qualifiers
FT   CDS             complement(139120..139674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0132"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54131"
FT                   /protein_id="ABQ54131.1"
FT                   /translation="MPIQRIEEIILQIPKLSYRILRLANSASLYMSKKIESLMDAISQL
FT                   GLMQIRNWLNLLLLASLDDVAPDLLERTLIRAKMCESLAKSMDYPNSHQAYTVGILSTL
FT                   DGILNEPMPSLLAKIRLSEALNEALLNYKGDLGKILKFAIDYEQANFNQLERIPVKSET
FT                   LSQSYLKGIEYANHVIDIINK"
     MPIQRIEEII LQIPKLSYRI LRLANSASLY MSKKIESLMD AISQLGLMQI RNWLNLLLLA        60
     SLDDVAPDLL ERTLIRAKMC ESLAKSMDYP NSHQAYTVGI LSTLDGILNE PMPSLLAKIR       120
     LSEALNEALL NYKGDLGKIL KFAIDYEQAN FNQLERIPVK SETLSQSYLK GIEYANHVID       180
     IINK                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page