(data stored in ACNUC7421 zone)

EMBL: CP000675.PE134

CP000675.PE134       Location/Qualifiers
FT   CDS             complement(142016..142324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="YCII domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54134"
FT                   /protein_id="ABQ54134.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRNELKELIQKTEGKLC"
     MFIVQLTYLV PINEVNKYLQ AHREFLDYHY KQGLLVASGP MKPPTGGIII AATNDRAHLE        60
     SVFKQDPYYL AEIAEYQFIE FTPVKHRNEL KELIQKTEGK LC                          102
//

If you have problems or comments...

PBIL Back to PBIL home page