(data stored in ACNUC7421 zone)

EMBL: CP000675.PE138

CP000675.PE138       Location/Qualifiers
FT   CDS             145326..145793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54138"
FT                   /protein_id="ABQ54138.1"
FT                   /translation="MVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLKAKGH
FT                   VTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVAIAYR
FT                   DNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
     MVWPIIWRWI LDLGWLCFLL ILFWYFWKKR RDLVEARSWL KAKGHVTRCE WTRVGHSVWP        60
     RIEYIYEVYE KDLTGEYLFL DTTFNTPNSK YSRSIAYKVA IAYRDNSEID VYYNPNRPEQ       120
     SALDVTIPKK LTFILILISS LILLHIGIIV WRLLV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page