(data stored in ACNUC7421 zone)

EMBL: CP000675.PE140

CP000675.PE140       Location/Qualifiers
FT   CDS             146795..148534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0141"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54140"
FT                   /protein_id="ABQ54140.1"
FT                   /translation="MGNSRFYFANPDKFSRFINRWDLLLLILTFSVLFFLGWAGSQMAT
FT                   PYQLGDQIPISLEPSNLPFYALRTVLRMFIALIFSILFTFIVGALAAKNRRAEQIVIPA
FT                   IDILQSIPVLSFLSITVTGFIHLFPNSLLGPECASIFAIFSAQVWNMTFGFYQSLKTVP
FT                   HDLIEVSAMLRLSAWQRFWKVEVPFSMSGLLWNMMVSMSASWFFVVLSEAISVAHQNIR
FT                   LPGVGSYIALAIAQRDLHAVGYAILTMVIVIFLYDQILFRPLIAWSEKFKMEQSPDESE
FT                   YQSWLIDLIRSSRLMKRVTEWLAVFTNSFVNARWLRIGEVKAVKEIDFKRQKRLDRLWT
FT                   ALVLIAVITGGWFLLKFILAELKVSDIFHVFLLGAATGARVIILILLSSMLWIPVGVWI
FT                   GLRPRLAQKIQPIIQFVAAFPANLFYPLFVIAIVKFNLSVEIWVTPLMILGTQWYILFN
FT                   VIAGASSIPRDLYLAADNFGLKGWIWWKRLALPGIFPFYITGAITAAGGAWNASIVAEY
FT                   VSWGNITLKATGLGEYIQASTTAGDFPQIALGTAMMCVYVLAFNHLIWRPLYRLAEERF
FT                   NFN"
     MGNSRFYFAN PDKFSRFINR WDLLLLILTF SVLFFLGWAG SQMATPYQLG DQIPISLEPS        60
     NLPFYALRTV LRMFIALIFS ILFTFIVGAL AAKNRRAEQI VIPAIDILQS IPVLSFLSIT       120
     VTGFIHLFPN SLLGPECASI FAIFSAQVWN MTFGFYQSLK TVPHDLIEVS AMLRLSAWQR       180
     FWKVEVPFSM SGLLWNMMVS MSASWFFVVL SEAISVAHQN IRLPGVGSYI ALAIAQRDLH       240
     AVGYAILTMV IVIFLYDQIL FRPLIAWSEK FKMEQSPDES EYQSWLIDLI RSSRLMKRVT       300
     EWLAVFTNSF VNARWLRIGE VKAVKEIDFK RQKRLDRLWT ALVLIAVITG GWFLLKFILA       360
     ELKVSDIFHV FLLGAATGAR VIILILLSSM LWIPVGVWIG LRPRLAQKIQ PIIQFVAAFP       420
     ANLFYPLFVI AIVKFNLSVE IWVTPLMILG TQWYILFNVI AGASSIPRDL YLAADNFGLK       480
     GWIWWKRLAL PGIFPFYITG AITAAGGAWN ASIVAEYVSW GNITLKATGL GEYIQASTTA       540
     GDFPQIALGT AMMCVYVLAF NHLIWRPLYR LAEERFNFN                              579
//

If you have problems or comments...

PBIL Back to PBIL home page