(data stored in ACNUC7421 zone)

EMBL: CP000675.PE150

CP000675.PE150       Location/Qualifiers
FT   CDS             160195..162663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54150"
FT                   /protein_id="ABQ54150.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLTELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTFFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEQQQYFLEYALKNAEKVEDVVS
FT                   YLSSRHRTLPAPANYGAHSLYLIDGEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLELYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKAAQKYVSSKLGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSESTLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYM"
     MGKGIILRVL ENTILSPQVF DTLERLLPGY KVEYFKEQPD YRKSIARRID SLHDAFSFIL        60
     KAYPLDPKHT SLTVATLSTY AAECKASCDL EKLTLEELHL ELERFTAKLV EAIAIAWKWP       120
     KGKAVKEAIA SLNEAEQYVL MSRGRSDIAT IMPIEMGSET KYVLQYDESL SPVYEQWLTE       180
     LKQLKEYNFP KTPAWFKNLP PYQQAYYCNL NLSSVDPKKA LQHFNTFFGN WGDIAKRSLN       240
     LTTELNQIHT NSPPYPSWFN ELSPAQQAMI RVLSATPHEI KSSLKEFKKF MVEQARNDQY       300
     ASTLSLVPKL PQWYWVLSEQ QQYFLEYALK NAEKVEDVVS YLSSRHRTLP APANYGAHSL       360
     YLIDGEGKET LFYDKRYRSS HVASRDSLKF PEDVQQRHVD SNLVKVMEFA KPQQPLLLQT       420
     LISPIHAVDY IPTVVTDFLP ELPPDLELYK IAREAVTRSK RRHEIFQHNH PFNIAKRYYY       480
     TQATDTDSEF LLKAAQKYVS SKLGLQALID DYKAVLESPL GSATFWDYDG RELFLSSLEE       540
     LIILNMGGYS YGSCVSGKDR KAVELLHTDA MILYKAKYGN WPKFGIPKEK QERVNFINIV       600
     VDLYISRHQH ELAGQNAPGS EGIKTPDWYW PNDIAEAINE RLGTEKALAY DDRLATDNEV       660
     KNISKDLRSF FLPENELHCL LIAKQLGEKM CTMLYDVLSA LINEERRFQK SSKDSWKLRW       720
     FSDKDVSSTP TGILNIREVM HDENSGNDNV LRIGKIFAAV LNRPESDSSR TTATNSVYDR       780
     IRKLLQPLSS ESTLQTLAEE AILEWSSLFE SSKRENSGLV YM                          822
//

If you have problems or comments...

PBIL Back to PBIL home page