(data stored in ACNUC7421 zone)

EMBL: CP000675.PE152

CP000675.PE152       Location/Qualifiers
FT   CDS             complement(163678..163863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54152"
FT                   /protein_id="ABQ54152.1"
FT                   /translation="MRIILSILAIFMPWLVLLIKDNPGGAVVALIMQATLIGWPFASIW
FT                   AWRAVNPLTPASQSKQ"
     MRIILSILAI FMPWLVLLIK DNPGGAVVAL IMQATLIGWP FASIWAWRAV NPLTPASQSK        60
     Q                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page