(data stored in ACNUC7421 zone)

EMBL: CP000675.PE154

CP000675.PE154       Location/Qualifiers
FT   CDS             164913..165983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54154"
FT                   /protein_id="ABQ54154.1"
FT                   /translation="MRIATLFSAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLRQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASPKPSSAKPYPLYALPEDEQNL
FT                   TLDEANAKPGLIRFKYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKKIFNVHRSNNITYDRTKTPYQQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRPMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDALYRATR
FT                   DLPDYVDAYFMILKQP"
     MRIATLFSAV LFISPLWAAP KFFPSQPALN GVYDIKGTEL CSTAKHTLAY LNKGKNYDPQ        60
     VIHDGKVIKI SLDRVKKTLE FICQNQKKLN NPDFVKQHFD FIRWYPDLRQ AKQLSANKPL       120
     LQNIPKDKIL MTKYFVHLAG ASPKPSSAKP YPLYALPEDE QNLTLDEANA KPGLIRFKYG       180
     KQAILSGALK NQPVSELAYL SRDDLEAALL QGTVVADFGP TAGKKIFNVH RSNNITYDRT       240
     KTPYQQERFW YFKEVDGIKG YGKDAEYKIT VNPKVTFAAD LAEFGLGKLL MIQYQDKSGR       300
     PMTKMGILAD TGGAFNNNLY QIDYLAGSFA GKDALYRATR DLPDYVDAYF MILKQP           356
//

If you have problems or comments...

PBIL Back to PBIL home page