(data stored in ACNUC7421 zone)

EMBL: CP000675.PE184

CP000675.PE184       Location/Qualifiers
FT   CDS             complement(200533..200904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54184"
FT                   /protein_id="ABQ54184.1"
FT                   /translation="MKVLLSIKPEYAEKILNGKKKFEFRKVIPKAGAKTVLLYATKPIG
FT                   KVVGEFEVDSFLSEKPNKLWDLTSSFSGISECFFYKYFEGYETAHAFKISKVYRYKEPV
FT                   DIKTVLASGVIPQSFCYLK"
     MKVLLSIKPE YAEKILNGKK KFEFRKVIPK AGAKTVLLYA TKPIGKVVGE FEVDSFLSEK        60
     PNKLWDLTSS FSGISECFFY KYFEGYETAH AFKISKVYRY KEPVDIKTVL ASGVIPQSFC       120
     YLK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page