(data stored in ACNUC7421 zone)

EMBL: CP000675.PE19

CP000675.PE19        Location/Qualifiers
FT   CDS             22493..23899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0019"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54019"
FT                   /protein_id="ABQ54019.1"
FT                   /translation="MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDS
FT                   KNIPYIAWWRDFKDPTLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLM
FT                   TGYSRNPATGFPGVLIVFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQIA
FT                   ASYFTYLAEIERKEFLQTLANDLTQLAKVANKVYQGGLSSEIEQEELYSQVNLIQGELE
FT                   VTERNIVISRNALRYLLNQNPGEIKTVKKLLQLKNRKLIPGSLPLTVLENRPDMQVAEN
FT                   RLRASHEGIGVAESNLLPTIQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVL
FT                   GAVAKAKGVNKVSYYNYIDTLQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLN
FT                   DRLYQTGIQSYIETLNSKISLDKINISLNQDKLQELLSIVRLYQELAGGYRANLESEIK
FT                   SSGRATRTRL"
     MLRPVKIILL SVFLVGCYSE PYHRPHVEVI NKWSVKDKNV KNIDSKNIPY IAWWRDFKDP        60
     TLNQLIERGL ISNTSLGMSR GSIEAAEGEL KKIRYQWVPT LDLMTGYSRN PATGFPGVLI       120
     VFIPNYTINI INQIREQKRA KYTLAQVKAE DDALKLTIIS QIAASYFTYL AEIERKEFLQ       180
     TLANDLTQLA KVANKVYQGG LSSEIEQEEL YSQVNLIQGE LEVTERNIVI SRNALRYLLN       240
     QNPGEIKTVK KLLQLKNRKL IPGSLPLTVL ENRPDMQVAE NRLRASHEGI GVAESNLLPT       300
     IQLDYIGGLA AGDSRYALPK KTVKFNDQLL KAPIIDMPVL GAVAKAKGVN KVSYYNYIDT       360
     LQKALRDTTN ALSENERLTN KLKQTASAQK HLAKAYNLND RLYQTGIQSY IETLNSKISL       420
     DKINISLNQD KLQELLSIVR LYQELAGGYR ANLESEIKSS GRATRTRL                    468
//

If you have problems or comments...

PBIL Back to PBIL home page