(data stored in ACNUC7421 zone)

EMBL: CP000675.PE190

CP000675.PE190       Location/Qualifiers
FT   CDS             208807..209451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54190"
FT                   /protein_id="ABQ54190.1"
FT                   /translation="MCVNNVKNYLKKCSSCNDSGTITGIGGIRSNCSKCKFKRALVNFF
FT                   EKFWAFIINKPIQKYPVGFTIVVFLFYYFISKNFSELMRASSIIGLLGLLFAALKYKLD
FT                   QANYHKSLFDERYKLFCQIEEVIRRANALDATDEGLRMIDEIINRCQFLFGKITLEFII
FT                   EIRSNFIQLICLKKSNKNSAPEADKAMEFFASLITLRSLPSKFPELIISNY"
     MCVNNVKNYL KKCSSCNDSG TITGIGGIRS NCSKCKFKRA LVNFFEKFWA FIINKPIQKY        60
     PVGFTIVVFL FYYFISKNFS ELMRASSIIG LLGLLFAALK YKLDQANYHK SLFDERYKLF       120
     CQIEEVIRRA NALDATDEGL RMIDEIINRC QFLFGKITLE FIIEIRSNFI QLICLKKSNK       180
     NSAPEADKAM EFFASLITLR SLPSKFPELI ISNY                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page