(data stored in ACNUC7421 zone)

EMBL: CP000675.PE192

CP000675.PE192       Location/Qualifiers
FT   CDS             complement(209934..211376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54192"
FT                   /protein_id="ABQ54192.1"
FT                   /translation="MNNQFKAKSKTPLQFKVFHTLLGFAVFFSLITVPAEAQVIIFFEI
FT                   PVSSELLWWPIVFFSFQLIHSIYGFSYLRHALYLVILFHAIYILFLKFAIWLPASSFWQ
FT                   MQETYTQVLGRDFLYIAMSSLCLWACTLLPLKFINDIKENQRRLLFFAGLMLFSLLDRA
FT                   LLNPQSSSSEAQFIVPILIYYFLNIFSGTLFQFISRVEGITRQKDLARDLFKFQIPDIT
FT                   NAIDQKFKYHHILFCSSIVFFIASKTMAAKFISIGFLTINVGGIVFSLAYLTADMMTDV
FT                   YGIERTKQMVLFIIFCNLLLVGDVWITNLLAIGENDPFKSILHNQARMFIASATAFFLG
FT                   MTINSTVISIIKARQRKRGISLKKEFITTVWTRIATSSAFGIIIDVSLFSLVAFYGIVP
FT                   NEKLGSVIIFEDAYKISYEIVLAPVSILLIYFLKIKEKVDIYDELSNLNPFRINTSYNI
FT                   NANKFAENYVQPERRNDRKPHL"
     MNNQFKAKSK TPLQFKVFHT LLGFAVFFSL ITVPAEAQVI IFFEIPVSSE LLWWPIVFFS        60
     FQLIHSIYGF SYLRHALYLV ILFHAIYILF LKFAIWLPAS SFWQMQETYT QVLGRDFLYI       120
     AMSSLCLWAC TLLPLKFIND IKENQRRLLF FAGLMLFSLL DRALLNPQSS SSEAQFIVPI       180
     LIYYFLNIFS GTLFQFISRV EGITRQKDLA RDLFKFQIPD ITNAIDQKFK YHHILFCSSI       240
     VFFIASKTMA AKFISIGFLT INVGGIVFSL AYLTADMMTD VYGIERTKQM VLFIIFCNLL       300
     LVGDVWITNL LAIGENDPFK SILHNQARMF IASATAFFLG MTINSTVISI IKARQRKRGI       360
     SLKKEFITTV WTRIATSSAF GIIIDVSLFS LVAFYGIVPN EKLGSVIIFE DAYKISYEIV       420
     LAPVSILLIY FLKIKEKVDI YDELSNLNPF RINTSYNINA NKFAENYVQP ERRNDRKPHL       480
//

If you have problems or comments...

PBIL Back to PBIL home page