(data stored in ACNUC7421 zone)

EMBL: CP000675.PE193

CP000675.PE193       Location/Qualifiers
FT   CDS             complement(211369..211728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54193"
FT                   /protein_id="ABQ54193.1"
FT                   /translation="MEEKKFTGRFLRFVYQQIVLRFIGQVREPYLVRIDRIFTHPDTNE
FT                   LSVAFHIANKRVNQVQSVADFVKSDMIYLIDPRIVFDIGQQFGAHSEKLTILEKKQPDL
FT                   KTKCIAGLKRVFIDE"
     MEEKKFTGRF LRFVYQQIVL RFIGQVREPY LVRIDRIFTH PDTNELSVAF HIANKRVNQV        60
     QSVADFVKSD MIYLIDPRIV FDIGQQFGAH SEKLTILEKK QPDLKTKCIA GLKRVFIDE        119
//

If you have problems or comments...

PBIL Back to PBIL home page