(data stored in ACNUC7421 zone)

EMBL: CP000675.PE194

CP000675.PE194       Location/Qualifiers
FT   CDS             complement(211746..212399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54194"
FT                   /protein_id="ABQ54194.1"
FT                   /translation="MSTTILNESSQLLLAQTLNELIGRDEKLSPAALARQLGIPTNKIT
FT                   RILNGDVTDPKASTLLQIANYFDITIEQLLGLEPIARQEEIEQQQATRQLPIFEFSKVN
FT                   QSNAAKEWYRWVENEIAGEYYALAIDTDLYEPTFPKNSILIINTDIEPEDRSYILIKKK
FT                   NDPSYCSIKKYVLEGNQIYLYPINPKLPVEIFDDHLYTIAGVILEVHQRLRSKK"
     MSTTILNESS QLLLAQTLNE LIGRDEKLSP AALARQLGIP TNKITRILNG DVTDPKASTL        60
     LQIANYFDIT IEQLLGLEPI ARQEEIEQQQ ATRQLPIFEF SKVNQSNAAK EWYRWVENEI       120
     AGEYYALAID TDLYEPTFPK NSILIINTDI EPEDRSYILI KKKNDPSYCS IKKYVLEGNQ       180
     IYLYPINPKL PVEIFDDHLY TIAGVILEVH QRLRSKK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page