(data stored in ACNUC7421 zone)

EMBL: CP000675.PE195

CP000675.PE195       Location/Qualifiers
FT   CDS             212528..212776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54195"
FT                   /protein_id="ABQ54195.1"
FT                   /translation="MRAMEHDSKLIIYKGMIQYILDSTHYTLKHIAQLSNASLDNIRAI
FT                   HCHDLLPINFKSEVQLLKLYQIVLEVNMNQKSCSIAE"
     MRAMEHDSKL IIYKGMIQYI LDSTHYTLKH IAQLSNASLD NIRAIHCHDL LPINFKSEVQ        60
     LLKLYQIVLE VNMNQKSCSI AE                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page