(data stored in ACNUC7421 zone)

EMBL: CP000675.PE198

CP000675.PE198       Location/Qualifiers
FT   CDS             complement(214176..214991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54198"
FT                   /protein_id="ABQ54198.1"
FT                   /translation="MIPSRFITQWRAYAPWAFERQIEQDLIISRALVELFNDPLISESI
FT                   AFRGGTALYKLFVDKPARYSEDIDLVQLKAEPIGPVLDAIRAHLDPWLGKPNSKRSQGR
FT                   VTLIYRYIAEGLPAIPMKLKIEINTQEHFTVLGQHQKLFSISTDWFRGEANILTYQLEE
FT                   LLGTKLRALYQRKKGRDLFDLWYVDEHIDCNHQEIVRIFQHYIQQQNLNISKAQFEENL
FT                   ALKLSSELFIRDMDPLLVSGLSWDINYAAKHIKEKFLSSLPGESWKGAD"
     MIPSRFITQW RAYAPWAFER QIEQDLIISR ALVELFNDPL ISESIAFRGG TALYKLFVDK        60
     PARYSEDIDL VQLKAEPIGP VLDAIRAHLD PWLGKPNSKR SQGRVTLIYR YIAEGLPAIP       120
     MKLKIEINTQ EHFTVLGQHQ KLFSISTDWF RGEANILTYQ LEELLGTKLR ALYQRKKGRD       180
     LFDLWYVDEH IDCNHQEIVR IFQHYIQQQN LNISKAQFEE NLALKLSSEL FIRDMDPLLV       240
     SGLSWDINYA AKHIKEKFLS SLPGESWKGA D                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page