(data stored in ACNUC7421 zone)

EMBL: CP000675.PE203

CP000675.PE203       Location/Qualifiers
FT   CDS             complement(219385..221175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0205"
FT                   /product="Probable protease htpX like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54203"
FT                   /protein_id="ABQ54203.1"
FT                   /translation="MNIYGLVKVFLVALVIPAIGFAVSFFIINDVNQSLKSKGIGDVTL
FT                   FCEVLQSGQLEKKATAELQEACQEVTNIVLLGQGSVITAAIGILIPVLYWLASIITGES
FT                   RKRIALLFPIVLRISVLLIAISVLLQGAILTYAVYIGESYFYGRIHPVLIGLIGLGALI
FT                   GGLSLIVVAMSFGRKLKLSTMGKVLAASDAPQLFRFVRSLAEKLGAKEPQNIIVGLEPT
FT                   FYVTNSDIQVPGYEKQITGETLYISAPLARLLSKEEFASVVGHELGHFRGNDTIYSMRF
FT                   APVYAGLGMALGALAIDENEGASGLAKVPAIAMLSYMYELFSTNVAKISRDREHKADEA
FT                   GAEAGSALALATALIKVSLYSSLWNHARQENIERLNQGKIATNLSIVFQDTAKYDIEHE
FT                   NIEQIMKSTLEQSISHPTDNHPSVSLRLKALGVNTETITKDMLLIPEDAAIHLLDKSQK
FT                   IEEEITLLEHKLMIAYGVASPPKEAERNHLLHATYSLAAAMISADGRVDLGEVAVAEGI
FT                   GKKLFEDFDSIEFREYCNNPEQIPDVVQLSEAMKEILEDEHKYLIIQYLKAISETDGSV
FT                   SKDEELLLQKVASGLGISIT"
     MNIYGLVKVF LVALVIPAIG FAVSFFIIND VNQSLKSKGI GDVTLFCEVL QSGQLEKKAT        60
     AELQEACQEV TNIVLLGQGS VITAAIGILI PVLYWLASII TGESRKRIAL LFPIVLRISV       120
     LLIAISVLLQ GAILTYAVYI GESYFYGRIH PVLIGLIGLG ALIGGLSLIV VAMSFGRKLK       180
     LSTMGKVLAA SDAPQLFRFV RSLAEKLGAK EPQNIIVGLE PTFYVTNSDI QVPGYEKQIT       240
     GETLYISAPL ARLLSKEEFA SVVGHELGHF RGNDTIYSMR FAPVYAGLGM ALGALAIDEN       300
     EGASGLAKVP AIAMLSYMYE LFSTNVAKIS RDREHKADEA GAEAGSALAL ATALIKVSLY       360
     SSLWNHARQE NIERLNQGKI ATNLSIVFQD TAKYDIEHEN IEQIMKSTLE QSISHPTDNH       420
     PSVSLRLKAL GVNTETITKD MLLIPEDAAI HLLDKSQKIE EEITLLEHKL MIAYGVASPP       480
     KEAERNHLLH ATYSLAAAMI SADGRVDLGE VAVAEGIGKK LFEDFDSIEF REYCNNPEQI       540
     PDVVQLSEAM KEILEDEHKY LIIQYLKAIS ETDGSVSKDE ELLLQKVASG LGISIT           596
//

If you have problems or comments...

PBIL Back to PBIL home page