(data stored in ACNUC7421 zone)

EMBL: CP000675.PE204

CP000675.PE204       Location/Qualifiers
FT   CDS             complement(221543..221800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54204"
FT                   /protein_id="ABQ54204.1"
FT                   /translation="MDDSIFVKGIEELKRLIATQYDLTVSAHKIENGKIIISLANKRKN
FT                   LVLNELNFRDAIEFLPNSPTNDKDKEDRHSLFLEIKNQLS"
     MDDSIFVKGI EELKRLIATQ YDLTVSAHKI ENGKIIISLA NKRKNLVLNE LNFRDAIEFL        60
     PNSPTNDKDK EDRHSLFLEI KNQLS                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page