(data stored in ACNUC7421 zone)

EMBL: CP000675.PE205

CP000675.PE205       Location/Qualifiers
FT   CDS             221942..222466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54205"
FT                   /protein_id="ABQ54205.1"
FT                   /translation="MNYKKKDRIRVPENHAEKALTLGINSKLKLLVMSKASEWVELPPG
FT                   EIQSISNKHPTKALVIVVRAPMVNGEYVGNHPDLQELTYRDLWLYSSDYYLLEELEKPT
FT                   TGEALEQNQYWLQLRSKAGRAIEKFEPWAAKQQGKINITDDLKGWIKKEITSKAFEIQT
FT                   ISKILQNHYKF"
     MNYKKKDRIR VPENHAEKAL TLGINSKLKL LVMSKASEWV ELPPGEIQSI SNKHPTKALV        60
     IVVRAPMVNG EYVGNHPDLQ ELTYRDLWLY SSDYYLLEEL EKPTTGEALE QNQYWLQLRS       120
     KAGRAIEKFE PWAAKQQGKI NITDDLKGWI KKEITSKAFE IQTISKILQN HYKF             174
//

If you have problems or comments...

PBIL Back to PBIL home page