(data stored in ACNUC7421 zone)

EMBL: CP000675.PE207

CP000675.PE207       Location/Qualifiers
FT   CDS             222820..222945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54207"
FT                   /protein_id="ABQ54207.1"
FT                   /translation="MSQLREGRIGWNQATLILIKLQLEFIAIWCDFASKGRKENV"
     MSQLREGRIG WNQATLILIK LQLEFIAIWC DFASKGRKEN V                            41
//

If you have problems or comments...

PBIL Back to PBIL home page