(data stored in ACNUC7421 zone)

EMBL: CP000675.PE208

CP000675.PE208       Location/Qualifiers
FT   CDS             222938..225343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0210"
FT                   /product="5' DNA primase traC (Replication primase)"
FT                   /note="3' similarity to Hypothetical protein yfjI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54208"
FT                   /protein_id="ABQ54208.1"
FT                   /translation="MFDTISQFRAAIETSGLVPPENIIPGKMHRFPGIGKTKENKAGWC
FT                   LLFLDQLGGCYGDWSTGLSEIWWGKRNQKLTPDEKAQFKCQVQEAQLKALNEAAAIHQE
FT                   AAKRALSIWNSSKPAEANYPYLLSKNIEPKGIRCYKGLLVTPLRADGKIYSLQFIDPEG
FT                   NKQFLRGGRVAGCYFSLGNPRGADVICIVEGVATGKTINMATGYPVAVAFSSSNLLAIA
FT                   QVMSEQFPEHTLIICADDDADKEGNPGLTKANQAADILGAKVAIPYFGIDRPNKASDFN
FT                   DMAAFSGLDAVAETIRAVLFQSDDNNWPEPFPLSEEINAQPYPLDALPNTVRNAVEEVT
FT                   AFTKAPTPLVASAALAALSLAIQAHVDVKRTEGLISPVSLYLLTIADSGERKSTCDSFF
FT                   MKAIRDYESIAQEKAKPLIKDYQAEISIWEEKYRGVKEQIRILAKTNKPTHEQELRLVN
FT                   LEYEKPVSPLVPRLVYCDVTPEALKWNLAKVWPSGGILSSEAGTVLGSHGMGTESVMRN
FT                   LATLNQLWDGSPIPTERRGSESFTVNGARLTVGFQVQEVTLKHFLDRSNGLARGTGFLA
FT                   RFLIAYPESTQGNRFFTEPPESWFNLAKFNTRISEILNQEVTIDKNGSLSVIQVSLSPE
FT                   AKKAWICFHDVIEGELGVGGELSEISDVASKIADNAARVAALFKVFNQGVTGTINFDEF
FT                   ENASRIVAWHLHEAKRFFSGLALSDDQADIVKLDSWLVRYCHKKKTNIVSRRDVQRNIV
FT                   PIRLRDKKTLDIALNVLVEAKRIRQMQSGKKKGIYINPALLTGDVHDN"
     MFDTISQFRA AIETSGLVPP ENIIPGKMHR FPGIGKTKEN KAGWCLLFLD QLGGCYGDWS        60
     TGLSEIWWGK RNQKLTPDEK AQFKCQVQEA QLKALNEAAA IHQEAAKRAL SIWNSSKPAE       120
     ANYPYLLSKN IEPKGIRCYK GLLVTPLRAD GKIYSLQFID PEGNKQFLRG GRVAGCYFSL       180
     GNPRGADVIC IVEGVATGKT INMATGYPVA VAFSSSNLLA IAQVMSEQFP EHTLIICADD       240
     DADKEGNPGL TKANQAADIL GAKVAIPYFG IDRPNKASDF NDMAAFSGLD AVAETIRAVL       300
     FQSDDNNWPE PFPLSEEINA QPYPLDALPN TVRNAVEEVT AFTKAPTPLV ASAALAALSL       360
     AIQAHVDVKR TEGLISPVSL YLLTIADSGE RKSTCDSFFM KAIRDYESIA QEKAKPLIKD       420
     YQAEISIWEE KYRGVKEQIR ILAKTNKPTH EQELRLVNLE YEKPVSPLVP RLVYCDVTPE       480
     ALKWNLAKVW PSGGILSSEA GTVLGSHGMG TESVMRNLAT LNQLWDGSPI PTERRGSESF       540
     TVNGARLTVG FQVQEVTLKH FLDRSNGLAR GTGFLARFLI AYPESTQGNR FFTEPPESWF       600
     NLAKFNTRIS EILNQEVTID KNGSLSVIQV SLSPEAKKAW ICFHDVIEGE LGVGGELSEI       660
     SDVASKIADN AARVAALFKV FNQGVTGTIN FDEFENASRI VAWHLHEAKR FFSGLALSDD       720
     QADIVKLDSW LVRYCHKKKT NIVSRRDVQR NIVPIRLRDK KTLDIALNVL VEAKRIRQMQ       780
     SGKKKGIYIN PALLTGDVHD N                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page