(data stored in ACNUC7421 zone)

EMBL: CP000675.PE21

CP000675.PE21        Location/Qualifiers
FT   CDS             26021..26932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0021"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54021"
FT                   /protein_id="ABQ54021.1"
FT                   /translation="MAFFLITLCILILSFFCLAVMVLKFMQQPSSPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIHMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
     MAFFLITLCI LILSFFCLAV MVLKFMQQPS SPLSFSQYVK LMCSGVIAFI ADTVGVGSFA        60
     VNVALAKLLG TFRDDELPAV NNGAQVLPGA IESLFFIHMV DVDLTTLLTL VTGTCIGGLV       120
     GGFVVSQLSK QAIRLAMICS FALIIVLLIA HQLRLLPVGG DLTELHSWKL VIGFFAMVVC       180
     GSLTSVGVGL FVMVQGVLFL MNVSPVVAFP IMTTAGAMQQ PLTTLVFLQK NKIPLKKTLI       240
     LSFSGCLGVM ITIPIFTKLT ITWLHFLLLF ILIYNFLAIG HTYLRSRPVK QYVQSSVKLA       300
     AAD                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page